PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S07300.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 900aa    MW: 99536 Da    PI: 7.5911
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S07300.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.99.8e-29630681152
         RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    aek+isl++l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rk+k++
  Jcr4S07300.10 630 AEKTISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKLKKV 681
                    589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291620701IPR003035RWP-RK domain
PfamPF020421.5E-24633681IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 900 aa     Download sequence    Send to blast
MDDGAFNPNS RPRTFSGTAM DLDFIDELLD DGCWLETTDG FNFLQPGLSN SGVPSDPSQY  60
SPYLESSSSL ASTNLHQVIH QEAAENNLPG NPPCNNTRGK ELTESESQNQ SSLKITSSLV  120
QPEPSPIEGS ELGTRLWIAP MAGVQSSSSV KQRLIHAIGK LKECAKDMEV LVQIWVPTKK  180
EGKCVLTTIG QPSFHSLKNE SLASYRNVSE AYNFPVEGDS KESLGLPGRV FLGKLPESTP  240
DVRFFRSDEY PRKSYAKQYN IRGSLAVPVL ERGTGNCLGV VEVITTSQYI NYRPELETIC  300
KALEAVDLRS SQHFCPPSVK ACKEFCQAAV PEISEILGSV CKTHKLPLAL TWARCFQQGK  360
GGCRHFDENF AHSISTVDSA CFVADTEFLA FHAACSEQYL FLGQGIVGKA FMMNKQCFAT  420
DITSFSKTDY PLSHHAKVLD LHAAVAIPLR STYAGSADFV LELFLPKDCR DGEEQKRIWD  480
LLPIAIQQSC KSLHVVMDKE QEEDIRWQMA VNSNGRYNKQ ENHNFASSSL QQHYPESSSW  540
ITQMMEAQQK GKSVCVSWDT ENKPKQEFKV ATNYDDTPED LYSKQVFAES GQLHQNSGNK  600
NSIEVSKNSS FAGQHSSGSK KGGEKRRTKA EKTISLQVLR QYFAGSLKDA AKSIGVCPTT  660
LKRICRQHGI TRWPSRKLKK VGHSLKKLQL VIDSVQGAEG TIQIDSFYST FPELTSPNFR  720
ENGPSASLKT NDNLKPLNPW PDSGLSNGGV TASKSPSSSC SRSSGSSICC STGEKKHKIP  780
DNVVNTGDAI AVEDPSSILK RTRSDAELHA LYREEEHKPL ARSQSHKNIG RSSSKSNRVP  840
TSLPKKQLQK FSGLAVHLEL KPNFGEDKSE IQLATQLELT RTCNRNWQNV SIEMIYAELI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067165.10.0PREDICTED: protein NLP2
RefseqXP_012067164.10.0PREDICTED: protein NLP2
TrEMBLA0A067L0N80.0A0A067L0N8_JATCU; Uncharacterized protein
STRINGPOPTR_0004s21550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein